PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr022333.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 369aa    MW: 40924.8 Da    PI: 7.136
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr022333.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.72.2e-53281551128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelvv+yLkkkv++ +l++ ++i++vd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++ + 
  Pbr022333.1  28 LPPGFRFHPTDEELVVQYLKKKVTSAPLPV-SIIADVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSgGI 124
                  79****************************.89***************988899***************************************99556 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Pbr022333.1 125 QKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 155
                  77***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.76E-6424189IPR003441NAC domain
PROSITE profilePS5100561.63728189IPR003441NAC domain
PfamPF023655.6E-2829155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MESTDSSTGS QQEQQQPPQP PPPPQPNLPP GFRFHPTDEE LVVQYLKKKV TSAPLPVSII  60
ADVDLYKFDP WELPAKATFG EQEWYFFSPR DRKYPNGARP NRAATSGYWK ATGTDKPVLT  120
SGGIQKVGVK KALVFYGGKP PKGIKTNWIM HEYRLADNKP NNKPPGWDLG NKKNSLRLDD  180
WVLCRIYKKN NTHSPMDHER EDSMGDIMGP LMPPSMTHVG HHQDMKLHLP KSNLSYGPPF  240
MENDQIFFDG IMSSTDGSAS TPQLPLKRPI VPSLYWNNQE EDDQTAADPS SSKRIQLHQL  300
DTGTNSNGDG INGGATNNNS TSIANLLSQL PQTPSLHEHA VLGSLGDGLF RTPYQLPGRN  360
WYSDSNLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-742219211168NO APICAL MERISTEM PROTEIN
1ut4_B7e-742219211168NO APICAL MERISTEM PROTEIN
1ut7_A7e-742219211168NO APICAL MERISTEM PROTEIN
1ut7_B7e-742219211168NO APICAL MERISTEM PROTEIN
3swm_A8e-742219214171NAC domain-containing protein 19
3swm_B8e-742219214171NAC domain-containing protein 19
3swm_C8e-742219214171NAC domain-containing protein 19
3swm_D8e-742219214171NAC domain-containing protein 19
3swp_A8e-742219214171NAC domain-containing protein 19
3swp_B8e-742219214171NAC domain-containing protein 19
3swp_C8e-742219214171NAC domain-containing protein 19
3swp_D8e-742219214171NAC domain-containing protein 19
4dul_A7e-742219211168NAC domain-containing protein 19
4dul_B7e-742219211168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981160.0KF198116.1 Malus hupehensis NAC domain protein (NAC32) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009378497.10.0PREDICTED: NAC domain-containing protein 18-like
SwissprotQ9LD441e-114NAC56_ARATH; NAC transcription factor 56
TrEMBLD9ZJA40.0D9ZJA4_MALDO; NAC domain class transcription factor
STRINGPOPTR_0011s12420.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-116NAC domain containing protein 2